PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G354900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 552aa    MW: 60009.4 Da    PI: 7.4988
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G354900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding331.4e-10114158348
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +WT++E+ l++ +   + g+ W++ +r+  + Rt+ q+ s++qky+
  Seita.3G354900.1.p 114 KWTEDEHRLFLAGLPFYRGN-WNAMSREYLTSRTASQIASHYQKYR 158
                         8*****************99.************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.632107162IPR017930Myb domain
SuperFamilySSF466898.97E-11109162IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-10110160IPR006447Myb domain, plants
SMARTSM007177.3E-7111160IPR001005SANT/Myb domain
CDDcd001673.07E-5114157No hitNo description
PfamPF002491.8E-7114158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-7114159IPR009057Homeodomain-like
Gene3DG3DSA:3.80.10.104.4E-71250550IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF520582.38E-61250550IPR032675Leucine-rich repeat domain, L domain-like
PfamPF082633.6E-12252290IPR013210Leucine-rich repeat-containing N-terminal, plant-type
SMARTSM00369130343367IPR003591Leucine-rich repeat, typical subtype
SMARTSM00369120391415IPR003591Leucine-rich repeat, typical subtype
PfamPF005600.64396414IPR001611Leucine-rich repeat
SMARTSM0036967439463IPR003591Leucine-rich repeat, typical subtype
SMARTSM003697.2489513IPR003591Leucine-rich repeat, typical subtype
PfamPF005600.68491512IPR001611Leucine-rich repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MHHDGYAAAA AAPPPALAAS PEPEQEPKWT RRDDKFLELL LFTRNTVSLR VASGIIVLTP  60
PVWDMEIAAM AVAAEEVVPE AVVPAAPPVA ARKNSAERAV GAGGDKRNKK AAEKWTEDEH  120
RLFLAGLPFY RGNWNAMSRE YLTSRTASQI ASHYQKYRNR EKQREHDNCK RASIHDITEP  180
GIAAAFAVSG GKAAAWKGKT PELLAGVSSL EKRNQLQKPI AGTMELKLAP HVLFIIAALS  240
SESHKATCST ETDRLSLLDF KNSISSDPHA TLASWNDSIH FCKWEGISCD SAKHPRRATT  300
LYLAGQGLIG HISPSLGNLT FLAMLNLSQN GFSGALHPSL GHLNQLKFLV LGNNSLQGRI  360
PNELTNCTSL RAVDLSSNQL VGEIPVEIAS LSELASLDLS QNNLTGGIPS SLGNISTLSE  420
LITTENQLEG RIPEKLKWLH RLTLLALGRN KLSGPIPQSI FNLSSLEIIS LESNYLSMPY  480
LPTDLGTTLH NLQRLYLDYN QIGGVIPPSL SNASRLVDIN FSSNYFVGHV PIILGVLGKL  540
SWLNLEFNQI D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4mna_A8e-502495512621LRR receptor-like serine/threonine-protein ki
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443246.11e-167hypothetical protein SORBIDRAFT_08g016290
TrEMBLC5YP241e-167C5YP24_SORBI; Putative uncharacterized protein Sb08g016290
STRINGSb08g016290.11e-166(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144181825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09450.12e-16MYB_related family protein